Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1733) | |||||
|---|---|---|---|---|---|
| DME Name | Beta-lactamase (blaB), Citrobacter koseri | ||||
| Synonyms | Penicillinase; Cephalosporinase; Beta-lactam; Beta-lactamase TEM; IRT-4; TEM-1 | ||||
| Gene Name | blaB | ||||
| UniProt ID | |||||
| EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Citrobacter koseri (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MFKKRGRQTVLIAAVLAFFTASSPLLARTQGEPTQVQQKLAALEKQSGGRLGVALINTAD
RSQILYRGDERFAMCSTSKTMVAAAVLKQSETQHDILQQKMVIKKADLTNWNPVTEKYVD KEMTLAELSAATLQYSDNTAMNKLLEHLGGTSNVTAFARSIGDTTFRLDRKEPELNTAIP GDERDTTCPLAMAKSLHKLTLGDALAGAQRAQLVEWLKGNTTGGQSIRAGLPEGWVVGDK TGAGDYGTTNDIAVIWPEDRAPLILVTYFTQPQQDAKGRKDILAAAAKIVTEGL |
||||
| Function | This enzyme hydrolyzes beta-lactam. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
Cefotaxime |
Drug Info | Approved | Meningitis | ICD11: 1A62 | [1] |
Cefoxitin |
Drug Info | Approved | Peritonitis | ICD11: DC50 | [2] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

