Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1745) | |||||
|---|---|---|---|---|---|
| DME Name | Cytochrome P450 109B1 (cyp109), Bacillus anthracis | ||||
| Synonyms | Cytochrome P450 family 109 subfamily B member 1; Flavocytochrome P450 109B1; P450 109B1; cyp109B1; BSUW23_09845 | ||||
| Gene Name | CYP109B1 | ||||
| UniProt ID | |||||
| EC Number | EC: 1.14.14.1 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Bacillus anthracis (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MNVLNRRQALQRALLNGKNKQDAYHPFPWYESMRKDAPVSFDEENQVWSVFLYDDVKKVI
GDKELFSSYMPQQSSAIGNSIINMDPPRHTQIRSVVNKAFTPRVMKQWEPRIQEITDELI QKFQGRSEFDLVHDFSYPLPVIVISELLGVPSEHMDQFKTWSDLLVSTPKDKSEEAEEAF LEERNKCEEELAAFFANIIEEKRNKPAQDVISILVEAEETGEKLSGEELVPFCTLLLVAG NETTTNLISNAMYSILETPDVYNVLRSHPELTPQAVEEALRFRAPAPVLRRIAKRDTEIG GHLIKEGDMVLAFVASANRDETKFDRAHLFDIHRHPNPHIAFGHGIHFCLGAPLARLEAK IALTSLISAFPHMECVSITPIENSVIYGLKSFRVKM |
||||
| Function | This enzyme is P-450 heme-thiolate protein, acting on a wide range of substrates including many xenobiotics, steroids, fatty acids, vitamins and prostaglandins; reactions catalysed include hydroxylation, epoxidation, N-oxidation, sulfooxidation, N-, S- and O-dealkylations, desulfation, deamination, and reduction of azo, nitro and N-oxide groups. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Beta-ionone |
Drug Info | Investigative | Breast cancer | ICD11: 2C60 | [1], [2] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

