Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1837) | |||||
|---|---|---|---|---|---|
| DME Name | Azoreductase (azoR), Corynebacterium acnes | ||||
| Synonyms | Azo-dye reductase; FMN-dependent NADH-azo compound oxidoreductase; FMN-dependent NADH-azoreductase; azoR; CPF_0793 | ||||
| Gene Name | azoR | ||||
| UniProt ID | |||||
| Gene ID | |||||
| EC Number | EC: 1.7.1.6 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Corynebacterium acnes (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MSKVLYIKANIKNEGESRTFKVSDSFVEEYKKNNPEDEIITLDLYKENIDFLRADDLGKL
FGPKDEESKNNSILKYAYQFADADKYIIAAPMWNLSFPAILKAYIDYVSVSGITFKYTAE GPVGLLNNKKAVHIVSRGGGYDNSPYEMGDRYLRTILGFFGIKDIETIAIDNLDVMGVNV EEKVEEGIEKAISLAKKF |
||||
| Function | This enzyme catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs in Phase 2 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
CTK0H-9987 |
Drug Info | Phase 2 | Trachoma | ICD11: 1C23 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Developing a metagenomic view of xenobiotic metabolism. Pharmacol Res. 2013 Mar;69(1):21-31. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

