Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1852) | |||||
|---|---|---|---|---|---|
| DME Name | Beta-glucosidase (bglA), Bifidobacterium breve | ||||
| Synonyms | Periplasmic beta-glucosidase; Glucan endo-1 3-beta-D-glucosidase; Beta-D-glucosidase; Bifunctional beta-D-glucosidase/beta-D-fucosidase | ||||
| Gene Name | bglA | ||||
| UniProt ID | |||||
| EC Number | EC: 3.2.1.21 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Bifidobacterium breve (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MTMIFPKGFMFGTATAAYQIEGAVAEGGRTPSIWDTFSHTGHTLNGDTGDVADDFYHRWE
DDLKLLRDLGVNAYRFSIGIPRVIPTPDGKPNQEGLDFYSRIVDRLLEYGIAPIVTLYHW DLPQYMASGDGREGGWLERETAYRIADYAGIVAKCLGDRVHTYTTLNEPWCSAHLSYGGT EHAPGLGAGPLAFRAAHHLNLAHGLMCEAVRAEAGAKPGLSVTLNLQICRGDADAVHRVD LIGNRVFLDPMLRGRYPDELFSITKGICDWGFVCDGDLDLIHQPIDVLGLNYYSTNLVKM SDRPQFPQSTEASTAPGASDVDWLPTAGPHTEMGWNIDPDALYETLVRLNDNYPGMPLVV TENGMACPDKVEVGTDGVKMVHDNDRIDYLRRHLEAVYRAIEEGTDVRGYFAWSLMDNFE WAFGYSKRFGLTYVDYESQERVKKDSFDWYRRFIADHSAR |
||||
| Function | This enzyme has bifunctional beta-D-glucosidase/beta-D-fucosidase. And it's activity towards pNP-beta-D-fucoside is about 80-85% of the activity towards pNP-beta-D-glucoside. Also has slight activity (less than 10%) towards pNP-beta-D-galactoside, and very low activity (less than 1%) towards pNP-beta-D-xyloside. And it also hydrolyzes laminaribiose, sophorose, cellobiose and gentobiose. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Ginsenoside Rb1 |
Drug Info | Investigative | Obesity | ICD11: 5B81 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Developing a metagenomic view of xenobiotic metabolism. Pharmacol Res. 2013 Mar;69(1):21-31. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

