Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1923) | |||||
---|---|---|---|---|---|
DME Name | Glycerol/diol dehydratase (dhaB), Lactobacillus reuteri | ||||
Synonyms | Glycerol dehydratase; Propanediol dehydratase pduC; dhaB; gldC; pduC | ||||
Gene Name | gldC | ||||
UniProt ID | |||||
EC Number | EC: 4.2.1.30 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Lactobacillus reuteri (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
RYAPFNAISILIGAQTGRPGVLTQCSVEEATELQLGMRGFTAYAETISVYGTDRVFTDGD
DTPWSKGFLASCYASRGLKMRFTSGAGSEVLMGYPEGKSMLYLEARCILLTKASGVQGLQ NGAVSCIEIPGAVPNGIREVLGENLLCMMCDIEC |
||||
Function | This enzyme has two forms. One form requires a cobamide coenzyme, while the other is a glycyl radical enzyme. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
PhIP |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
References | |||||
---|---|---|---|---|---|
1 | Gut microbial beta-glucuronidase and glycerol/diol dehydratase activity contribute to dietary heterocyclic amine biotransformation. BMC Microbiol. 2019 May 16;19(1):99. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.