Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1958) | |||||
---|---|---|---|---|---|
DME Name | Nitroreductase (NTR), Prevotella copri | ||||
Synonyms | FMN reductase (NAD(P)H); FMN reductase NADPH; nfrA2; DW916_02940 | ||||
Gene Name | NTR | ||||
UniProt ID | |||||
EC Number | EC: 1.5.1.39 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Prevotella copri (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MESIKNRTSIRKYAEKEVSEELLNRLLEEAERTPTMGNLQLYSVVVTRSEEGKKALAPAH
FNQPMVTGAPVVLTICADYRRTTLWAENRKGTPGYDNILSFMNAATDALLFTQTFTNLAE EAGLGTCFLGTTVYMPKMIIDTLKLPKLVMPVATLTIGWPAEHPALSDRLPLRSIIHHEH FEDYTPEKIDDFYAEKEALEENKEFVRINNVETLAQVFTDIRYTKKDCEAMSQGFLEALK QQGFI |
||||
Function | This enzyme uses NADH as source of reducing equivalents to reduce of a variety of nitroaromatic compounds. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs in Phase 3 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Nitrazepam |
Drug Info | Phase 3 | Insomnia | ICD11: 7A00 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Distinct genetic and functional traits of human intestinal Prevotella copri strains are associated with different habitual diets. Cell Host Microbe. 2019 Mar 13;25(3):444-453.e3. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.