Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME2031) | |||||
|---|---|---|---|---|---|
| DME Name | Beta-lactamase (blaB), Vibrio vulnificus | ||||
| Synonyms | Penicillinase; Cephalosporinase; Beta-lactam; blaCARB; DBX26_23310 | ||||
| Gene Name | blaCARB | ||||
| UniProt ID | |||||
| EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Vibrio vulnificus (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MKKLLFLLALMVASPLSHASKLHEDVSLLEQQISGRIGIAVWDTQTDKHWAYRGDERFPL
VGTFKTLACATMLSEMDTGILKKNATATVEKRDMVMWSPIMDKLAGQNVRIEHACEAAML MNDNTATNLVLSEIGGPKSVMLFLRTIGDKATRLDSAEPSVNEAMPGDKHDTTTPNAMVN TLETLIDGDALSYESRIQLKIWMQDSKVSDPLMRSVLPSGWSIADRSGAGGNGSLGFNAI IWKENHKPVYISIYLAETELSLQAREQLIAQISQLILYKYRNI |
||||
| Function | This enzyme hydrolyzes beta-lactam. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs in Phase 4 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Imipenem |
Drug Info | Phase 4 | Acute pancreatitis | ICD11: DC31 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Carbapenemase VCC-1-producing Vibrio cholerae in coastal waters of Germany. Emerg Infect Dis. 2017 Oct;23(10):1735-1737. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

