Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME2057) | |||||
|---|---|---|---|---|---|
| DME Name | Aminoglycoside 6'-N-acetyltransferase (aacA), Klebsiella pneumoniae | ||||
| Synonyms | Aminoglycoside 6'-N-acetyltransferase type II AAC6'Ib; Aminoglycoside N-acetyltransferase; aac(6')-Ib | ||||
| Gene Name | aac(6')-Ib | ||||
| UniProt ID | |||||
| EC Number | EC: 2.3.1.82 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Klebsiella pneumoniae (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human lung. | ||||
| Sequence |
MTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPI
GYAQSYVALGSGDGWWEEETDPGVRGIDQSLANASQLGKGLGTKLVRALVELLFNDPEVT KIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSDA |
||||
| Function | This enzyme catalyzes the transfer of an acetyl group from acetyl-CoA to the 6'-amino group of aminoglycoside molecules conferring resistance to antibiotics containing the purpurosamine ring including amikacin, kanamycin, tobramycin and netilmicin. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Gentamicin |
Drug Info | Approved | Acute upper respiratory infection | ICD11: CA07 | [1] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

