Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME2063) | |||||
|---|---|---|---|---|---|
| DME Name | Cytochrome P450 107L2 (cyp107), Streptomyces avermitilis | ||||
| Synonyms | Cytochrome P450 family 107 subfamily L member 2; Cytochrome P450 monooxygenase 107L2; Narbomycin C-12 hydroxylase 107L2; Pikromycin synthase CYP107L2 | ||||
| Gene Name | pikC | ||||
| UniProt ID | |||||
| EC Number | EC: 1.14.15.11 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Streptomyces avermitilis (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MRRTQQGTTASPPVLDLGALGQDFAADPYPTYARLRAEGPAHRVRTPEGDEVWLVVGYDR
ARAVLADPRFSKDWRNSTTPLTEAEAALNHNMLESDPPRHTRLRKLVAREFTMRRVELLR PRVQEIVDGLVDAMLAAPDGRADLMESLAWPLPITVISELLGVPEPDRAAFRVWTDAFVF PDDPAQAQTAMAEMSGYLSRLIDSKRGQDGEDLLSALVRTSDEDGSRLTSEELLGMAHIL LVAGHETTVNLIANGMYALLSHPDQLAALRADMTLLDGAVEEMLRYEGPVESATYRFPVE PVDLDGTVIPAGDTVLVVLADAHRTPERFPDPHRFDIRRDTAGHLAFGHGIHFCIGAPLA RLEARIAVRALLERCPDLALDVSPGELVWYPNPMIRGLKALPIRWRRGREAGRRTG |
||||
| Structure | |||||
| Function | This enzyme is a P-450 heme-thiolate protein, and it is involved in the biosynthesis of a number of bacterial macrolide antibiotics containing a desosamine glycoside unit. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
Lauric acid |
Drug Info | Investigative | Alzheimer disease | ICD11: 8A20 | [1], [2] |
Oligomycin C |
Drug Info | Investigative | Colon cancer | ICD11: 2B90 | [3] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

