Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN007) | |||||
|---|---|---|---|---|---|
| DME Name | Sulfotransferase 1A4 (SULT1A4), Homo sapiens | ||||
| Gene Name | SULT1A4 | ||||
| UniProt ID | |||||
| EC Number | EC: 1.14.13.39 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDM
IYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLD QKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWW ELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNY TTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL |
||||
| Function | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
Levodopa |
Drug Info | Approved | Parkinsonism | ICD11: 8A00 | [1] |
Acetaminophen |
Drug Info | Approved | Anaesthesia | ICD11: 8E22 | [2] |
| Drugs in Phase 4 Clinical Trial | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
Mestranol |
Drug Info | Phase 4 | Menorrhagia | ICD11: GA20 | [3] |
Phenacetin |
Drug Info | Phase 4 | Anaesthesia | ICD11: 8E22 | [4] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

