Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN039) | |||||
|---|---|---|---|---|---|
| DME Name | Bifunctional trans-3-hydroxy-L-proline dehydratase/2-epimerase (lhpL), Pseudomonas aeruginosa | ||||
| Gene Name | lhpL | ||||
| UniProt ID | |||||
| EC Number | EC: 2.7.1.35 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Pseudomonas aeruginosa (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MRSQRIVHIVSCHAEGEVGDVIVGGVAAPPGATLWEQSRWIARDQDLRNFVLNEPRGGVF
RHANLLVPAKDPRAQMGWIIMEPADTPPMSGSNSLCVATVLLDSGILPMREPLTRLLLEA PGGLIEARAECRDGKAERVEIRNVPSFADRLDAWIEVEGLGSLQVDTAYGGDSFVIADAR RLGFALRADEAAELVATGLKITHAANEQLGFRHPTNPDWDHLSFCQLAAPPERRDGVLGA NNAVVIRPGKIDRSPCGTGCSARMAVLQAKGQLRVGERFVGRSIIGSEFHCHIESLTELG GRPAILPCLSGRAWITGIHQYLLDPDDPWPQGYRLSDTWPGGHC |
||||
| Function | Bifunctional enzyme catalyzing both the dehydration of trans-3-hydroxy-L-proline (t3LHyp) to Delta(1)-pyrroline-2-carboxylate (Pyr2C) and 2-epimerization of t3LHyp to cis-3-hydroxy-D-proline (c3DHyp). No dehydratase activity with L-proline, trans-4-hydroxy-L-proline (t4LHyp), cis-4-hydroxy-L-proline (c4LHyp), D-proline, cis-4-hydroxy-D-proline (c4DHyp), trans-4-hydroxy-D-proline (t4DHyp) or L-serine as substrates. Displays neither t4LHyp epimerase nor proline racemase activity. Is likely involved in a degradation pathway that converts t3LHyp to L-proline, which would allow P.aeruginosa to grow on t3LHyp as a sole carbon source. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
AK-41099 |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

