Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DMEN041)
DME Name Nucleoside diphosphate kinase (ndk), Escherichia coli
Gene Name ndk
UniProt ID
NDK_ECOLI
EC Number    EC: 4.2.1.77     (Click to Show/Hide the Complete EC Tree)
Lyases
Carbon-oxygen lyase
Hydro-lyase
EC: 4.2.1.77
Lineage    Species: Escherichia coli     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Bacteria
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MAIERTFSIIKPNAVAKNVIGNIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFF
DGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSD
SVESAAREIAYFFGEGEVCPRTR
Structure
2HUR ;
Function Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          2 Drugs
Gemcitabine
 Drug Info Approved Breast cancer ICD11: 2C60 [1]
Decitabine
 Drug Info Approved Myelodysplastic syndrome ICD11: 2A36 [2]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR000750 5-aza-2'-deoxycytidine-diphosphate 5-aza-2'-deoxycytidine-triphosphate Other reaction - Phosphorylation Decitabine [2]
MR001120 Gemcitabine diphosphate Gemcitabine triphosphate Other reaction - Phosphorylation Gemcitabine [1], [3], [4]
References
1 Intracellular pharmacokinetics of gemcitabine, its deaminated metabolite 2',2'-difluorodeoxyuridine and their nucleotides Br J Clin Pharmacol. 2018 Jun;84(6):1279-1289. doi: 10.1111/bcp.13557.
2 Kinetic interaction of 5-AZA-2'-deoxycytidine-5'-monophosphate and its 5'-triphosphate with deoxycytidylate deaminase Mol Pharmacol. 1984 May;25(3):436-40.
3 A metal-dependent conformational change provides a structural basis for the inhibition of CTP synthase by gemcitabine-5'-triphosphate. Protein Sci. 2023 Jun;32(6):e4648. doi: 10.1002/pro.4648.
4 Microangiopathy associated with gemcitabine: a drug interaction with nab-paclitaxel? A case series and literature review. Eur J Clin Pharmacol. 2022 Jul;78(7):1087-1093. doi: 10.1007/s00228-022-03324-z.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.