Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DMEN050)
DME Name Glycine cleavage system H protein, mitochondrial (GCSH), Homo sapiens
Gene Name GCSH
UniProt ID
GCSH_HUMAN
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MALRVVRSVRALLCTLRAVPSPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWV
TTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEV
TEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
Function The glycine cleavage system catalyzes the degradation of glycine. The H protein (GCSH) shuttles the methylamine group of glycine from the P protein (GLDC) to the T protein (GCST).
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          1 Drugs
Glycine
 Drug Info Approved Vitamin deficiency ICD11: 5B55 [1]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR002921 Dihydrolipoamide Lipoic acid Unclear - Unclear Glycine [2]
MR002923 Glycine Methylamine Oxidation - Oxidative Decarboxylation Glycine [1]
MR002920 Methylamine Dihydrolipoamide Unclear - Unclear Glycine [2]
References
1 Glycine metabolism in animals and humans: implications for nutrition and health Amino Acids. 2013 Sep;45(3):463-77. doi: 10.1007/s00726-013-1493-1.
2 DrugBank(Pharmacology-Metabolism)Glycine

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.