Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN051) | |||||
|---|---|---|---|---|---|
| DME Name | Aminomethyltransferase (AMT), Homo sapiens | ||||
| Gene Name | AMT | ||||
| UniProt ID | |||||
| EC Number | EC: 1.14.17.1 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MQRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVAFAGWSLPVQ
YRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFT NEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALL ALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGA VHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAM DFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNV AMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTLK |
||||
| Structure | |||||
| Function | The glycine cleavage system catalyzes the degradation of glycine. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Glycine |
Drug Info | Approved | Vitamin deficiency | ICD11: 5B55 | [1] |
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
L-histidine |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [2] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | DrugBank(Pharmacology-Metabolism)Glycine | ||||
| 2 | Histidine in Health and Disease: Metabolism, Physiological Importance, and Use as a Supplement | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

