Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN110) | |||||
|---|---|---|---|---|---|
| DME Name | Cysteine dioxygenase type 1 (CDO1), Homo sapiens | ||||
| Gene Name | CDO1 | ||||
| UniProt ID | |||||
| EC Number | EC: 1.13.11.20 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTR
NLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKK SERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMT FHSKFGIRTPNATSGSLENN |
||||
| Structure | |||||
| Function | Catalyzes the oxidation of cysteine to cysteine sulfinic acid with addition of molecular dioxygen. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs in Phase 1 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
E-920 |
Drug Info | Phase 1 | Lung cancer | ICD11: 2C25 | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | The mercaptopyruvate pathway in cysteine catabolism: a physiologic role and related disease of the multifunctional 3-mercaptopyruvate sulfurtransferase | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

