Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN126) | |||||
|---|---|---|---|---|---|
| DME Name | Cytochrome P450 2C11 (Cyp2c11), Rattus norvegicus | ||||
| Gene Name | Cyp2c11 | ||||
| UniProt ID | |||||
| EC Number | EC: 1.14.14.1 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Rattus norvegicus (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Liver and kidney; male-specific. . | ||||
| Sequence |
MDPVLVLVLTLSSLLLLSLWRQSFGRGKLPPGPTPLPIIGNTLQIYMKDIGQSIKKFSKV
YGPIFTLYLGMKPFVVLHGYEAVKEALVDLGEEFSGRGSFPVSERVNKGLGVIFSNGMQW KEIRRFSIMTLRTFGMGKRTIEDRIQEEAQCLVEELRKSKGAPFDPTFILGCAPCNVICS IIFQNRFDYKDPTFLNLMHRFNENFRLFSSPWLQVCNTFPAIIDYFPGSHNQVLKNFFYI KNYVLEKVKEHQESLDKDNPRDFIDCFLNKMEQEKHNPQSEFTLESLVATVTDMFGAGTE TTSTTLRYGLLLLLKHVDVTAKVQEEIERVIGRNRSPCMKDRSQMPYTDAVVHEIQRYID LVPTNLPHLVTRDIKFRNYFIPKGTNVIVSLSSILHDDKEFPNPEKFDPGHFLDERGNFK KSDYFMPFSAGKRICAGEALARTELFLFFTTILQNFNLKSLVDVKDIDTTPAISGFGHLP PFYEACFIPVQRADSLSSHL |
||||
| Function | A cytochrome P450 monooxygenase involved in the metabolism of steroid hormones and fatty acids. Catalyzes the hydroxylation of carbon-hydrogen bonds. Metabolizes testosterone to 2alpha- and 16alpha-hydroxytestosterone . Catalyzes the epoxidation of double bonds of polyunsaturated fatty acids (PUFAs) . Converts arachidonic acid (ARA, C20:4(n-6)) primarily to epoxyeicosatrienoic acid (EET) regioisomers, 8,9-, 11,12-, and 14,15-EET, with both R,S and S,R stereochemistry . Preferentially produces 11R,12S-EET enantiomer. To a lesser extent, catalyzes the hydroxylation of arachidonic acid producing hydroxyeicosatetraenoates (HETEs) . Metabolizes eicosapentaenoic acid (EPA, C20:5(n-3)) to epoxyeicosatetraenoic acid (EETeTr) regioisomers, 8,9-, 11,12-, 14,15-, and 17,18-EETeTr, preferentially producing 17R,18S-EETeTr enantiomer . Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase) . | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Metformin |
Drug Info | Approved | Type-2 diabetes | ICD11: 5A11 | [1] |
| Drugs in Phase 2 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Amiodarone |
Drug Info | Phase 2/3 | Ventricular tachyarrhythmia | ICD11: BC71 | [2] |
| Drugs in Phase 1 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
MN-1695 |
Drug Info | Phase 1 | Gastric ulcer | ICD11: DA60 | [3] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

