Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN149) | |||||
|---|---|---|---|---|---|
| DME Name | 2-aminophenol 1,6-dioxygenase beta subunit (amnB), Pseudomonas sp | ||||
| Gene Name | amnB | ||||
| UniProt ID | |||||
| EC Number | EC: 1.13.11.74 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Pseudomonas sp (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MANGEIISGFIAPHPPHLVYGENPPQNEPKSTGGWEQLRWAYERARASIEELKPDVLLVH
SPHWITSVGHHFIGVDHLQGRSVDPIFPNLFRFDYSINFDVELSEACCEEGRKAGLVTKM MRNPRFRPDYGTITTLHMIRPQWDIPVVSISANNTPYYLSMEEGLGEMDVLGKATREAIL KSGKRAVLLASNTLSHWHFHEEPVPPEDMSKEHPQTKIGYEWDMRMIELMRQGRMEEVFQ LLPQFIEEAFAEVKSGAFTWMHAAMQYPNLPAELHGYGTVIGTGNAVVEWNLVKAGLARV AGKAA |
||||
| Function | Component of the 2-aminophenol 1,6-dioxygenase complex that catalyzes the ring fission of 2-aminophenol to produce 2-aminomuconic 6-semialdehyde. AmnB seems to be the catalytic subunit of the complex. The enzyme is also active toward 2-amino-p-cresol, 6-amino-m-cresol, 2-amino-m-cresol, 2-amino-4,5-dimethylphenol, 2-amino-4-chlorophenol, and catechol. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Aminophenol |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Metabolism of 2-aminophenol by Pseudomonas sp. AP-3: modified meta-cleavage pathway | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.