Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN162) | |||||
|---|---|---|---|---|---|
| DME Name | NAD-dependent protein deacetylase HST1 (HST1), Saccharomyces cerevisiae | ||||
| Gene Name | HST1 | ||||
| UniProt ID | |||||
| EC Number | EC: 2.3.1.286 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Saccharomyces cerevisiae (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MNILLMQRIVSFILVVSQGRYFHVGELTMTMLKRPQEEESDNNATKKLKTRLTYPCILGK
DKVTGKFIFPAITKDDVMNARLFLKDNDLKTFLEYFLPVEVNSIYIYFMIKLLGFDVKDK ELFMALNSNITSNKERSSAELSSIHAKAEDEDELTDPLEKKHAVKLIKDLQKAINKVLST RLRLPNFNTIDHFTATLRNAKKILVLTGAGVSTSLGIPDFRSSEGFYSKIRHLGLEDPQD VFNLDIFLQDPSVFYNIAHMVLPPENMYSPLHSFIKMLQDKGKLLRNYTQNIDNLESYAG IDPDKLVQCHGSFATASCVTCHWQIPGEKIFENIRNLELPLCPYCYQKRKQYFPMSNGNN TVQTNINFNSPILKSYGVLKPDMTFFGEALPSRFHKTIRKDILECDLLICIGTSLKVAPV SEIVNMVPSHVPQILINRDMVTHAEFDLNLLGFCDDVASLVAKKCHWDIPHKKWQDLKKI DYNCTEIDKGTYKIKKQPRKKQQ |
||||
| Function | NAD-dependent histone deacetylase involved in telomeric silencing. Histone deacetylase proteins act via the formation of large multiprotein complexes that are responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Restores silencing at HMR in SIR2 mutants when overexpressed. Required to repress middle sporulation genes during vegetative growth. Acts as a sensor of NAD(+) levels and regulator of NAD(+) biosynthesis. Regulates the gene expression of de novo NAD(+) biosynthesis genes. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
D-ribosylnicotinate |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Nicotinamide riboside and nicotinic acid riboside salvage in fungi and mammals. Quantitative basis for Urh1 and purine nucleoside phosphorylase function in NAD+ metabolism | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

