Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN170) | |||||
|---|---|---|---|---|---|
| DME Name | Lactoylglutathione lyase (GLO1), Homo sapiens | ||||
| Gene Name | GLO1 | ||||
| UniProt ID | |||||
| EC Number | EC: 4.4.1.5 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQK
CDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNS DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM ATLM |
||||
| Structure | |||||
| Function | Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione . Involved in the regulation of TNF-induced transcriptional activity of NF-kappa-B . Required for normal osteoclastogenesis (By similarity). | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Methylglyoxal |
Drug Info | Investigative | Alzheimer disease | ICD11: 8A20 | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Cells producing their own nemesis: understanding methylglyoxal metabolism | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

