Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN190) | |||||
|---|---|---|---|---|---|
| DME Name | Hydrogenase-1 small chain (hyaA), Escherichia coli | ||||
| Gene Name | hyaA | ||||
| UniProt ID | |||||
| Gene ID | |||||
| EC Number | EC: 1.12.99.6 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Escherichia coli (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MNNEETFYQAMRRQGVTRRSFLKYCSLAATSLGLGAGMAPKIAWALENKPRIPVVWIHGL
ECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGTQAEEVFEDIITQYNGKYILAV EGNPPLGEQGMFCISSGRPFIEKLKRAAAGASAIIAWGTCASWGCVQAARPNPTQATPID KVITDKPIIKVPGCPPIPDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAH FDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAEN GFWDRGSFYSRVVDIPQMGTHSTADTVGLTALGVVAAAVGVHAVASAVDQRRRHNQQPTE TEHQPGNEDKQA |
||||
| Structure | |||||
| Function | This is one of three E.coli hydrogenases synthesized in response to different physiological conditions. HYD1 is believed to have a role in hydrogen cycling during fermentative growth. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Nitroimidazole |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Reduction of 2-, 4- and 5-nitroimidazole drugs by hydrogenase 1 in Clostridium pasteurianum | ||||
| 2 | U. S. FDA Label -Nitroimidazole | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

