Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN191) | |||||
|---|---|---|---|---|---|
| DME Name | 2-nitroimidazole nitrohydrolase (nnhA), Mycobacterium sp. | ||||
| Gene Name | nnhA | ||||
| UniProt ID | |||||
| EC Number | EC: 3.5.99.9 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Mycobacterium sp. (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MTTVDKRPSSRGYGDWRLSDIPQYKDGISTYEFVRATHEADYRTHQAEPVAGRTFGFNGI
GRLTEVALHMPTKYTLHDQSSQYKESPSFFQGLMGVPDRGPVDLAAFQRETEELATAFEN NGIKVHWVDYPEEPANPYGPLMGHVFLSWGSIWRGGSVISRFGFLPGMVGVSEYLAKWAW NTLNIPPLVAITEGAMEPGACNMIADEVLVTCLSASYDQRGTDQLVAAISKTSGTEEFHN LQLRPAVEGFFNKATGACAHPDININAIDVGKLVVSPAALDWDARTWLYDNNFELIEADP DEQREFLAPCNVLLLEPGKVIAHADCHKTNQKIRDAGVEVIEVTGTEIRKACGGIKCRVM QINREPGPTLADVRNRVWR |
||||
| Function | Involved in the biodegradation of 2-Nitroimidazole (2NI) which is a natural antibiotic and an analog of the synthetic nitroimidazoles used for treatment of tuberculosis, Chagas disease (also called American Trypanosomiasis) and cancer. Catalyzes the hydrolytic denitration of 2NI to produce imidazol-2-one and nitrite. It is also active against the 2NI synthetic derivative benznidazole. NnhA confers drug resistance to 2NI. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Nitroimidazole |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Catabolic pathway for 2-nitroimidazole involves a novel nitrohydrolase that also confers drug resistance | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

