Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN241) | |||||
|---|---|---|---|---|---|
| DME Name | NDP-glycosyltransferase YjiC (yjiC), Bacillus licheniformis | ||||
| Gene Name | yjiC | ||||
| UniProt ID | |||||
| EC Number | EC: 2.4.1.384 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Bacillus licheniformis (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MGHKHIAIFNIPAHGHINPTLALTASLVKRGYRVTYPVTDEFVKAVEETGAEPLNYRSTL
NIDPQQIRELMKNKKDMSQAPLMFIKEMEEVLPQLEALYENDKPDLILFDFMAMAGKLLA EKFGIEAVRLCSTYAQNEHFTFRSISEEFKIELTPEQEDALKNSNLPSFNFEDMFEPAKL NIVFMPRAFQPYGETFDERFSFVGPSLAKRKFQEKETPIISDSGRPVMLISLGTAFNAWP EFYHMCIEAFRDTKWQVIMAVGTTIDPESFDDIPENFSIHQRVPQLEILKKAELFITHGG MNSTMEGLNAGVPLVAVPQMPEQEITARRVEELGLGKHLQPEDTTAASLREAVSQTDGDP HVLKRIQDMQKHIKQAGGAEKAADEIEAFLAPAGVK |
||||
| Function | Glycosyltransferase that can glycosylate a wide range of substrates, including various flavonoids (flavones, flavonols, flavanones, flavanols, chalcones), isoflavonoids and stilbenes, to produce multiple glycosylated products . It can accept diverse nucleotide diphosphate-D/L-sugars as donors, including ADP-, GDP-, CDP-, TDP- or UDP-alpha-D-glucose, and catalyzes O-, N-, or S-glycosylation . In vitro, catalyzes the glycosylation of, among others, apigenin, 3-hydroxyflavone, phloretin or resveratrol, resulting in multiple glucosylated products, along with mono-, di-, tri- and tetraglucosides . Can also catalyze the glycosylation of the macrolide epothilone A with diverse NDP-D/L-sugars, forming different epothilone A glycoside derivatives . | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Tetracycline |
Drug Info | Approved | Spotted fever | ICD11: 1C31 | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Bioconversion of Tetracycline Antibiotics to Novel Glucoside Derivatives by Single-Vessel Multienzymatic Glycosylation | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

