Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN329) | |||||
|---|---|---|---|---|---|
| DME Name | Acetone carboxylase gamma subunit (acxC), Xanthobacter autotrophicus | ||||
| Gene Name | acxC | ||||
| UniProt ID | |||||
| EC Number | EC: 6.4.1.6 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Xanthobacter autotrophicus (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MAYTRSKIVDLVDGKIDPDTLHQMLSTPKDPERFVTYVEILQERMPWDDKIILPLGPKLF
IVQQKVSKKWTVRCECGHDFCDWKDNWKLSARVHVRDTPQKMEEIYPRLMAPTPSWQVIR EYFCPECGTLHDVEAPTPWYPVIHDFSPDIEGFYQEWLGLPVPERADA |
||||
| Structure | |||||
| Function | Catalyzes the carboxylation of acetone to form acetoacetate. Has a reduced activity on butanone, and no activity on 2-pentatone, 3-pentatone, 2-hexanone, chloroacetone, pyruvate, phosphoenolpyruvate, acetaldehyde, propionaldehyde and propylene oxide. | ||||
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | The human gastric pathogen Helicobacter pylori has a potential acetone carboxylase that enhances its ability to colonize mice. BMC Microbiol. 2008 Jan 23;8:14. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.