Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN738) | |||||
|---|---|---|---|---|---|
| DME Name | Valacyclovir hydrolase (BPHL), Homo sapiens | ||||
| Gene Name | BPHL | ||||
| UniProt ID | |||||
| EC Number | EC: 3.1.-.- (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MVAVLGGRGVLRLRLLLSALKPGIHVPRAGPAAAFGTSVTSAKVAVNGVQLHYQQTGEGD
HAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKD AVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIR DVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVH GEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ |
||||
| Structure | |||||
| Function | Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 4 Drugs | ||||
Valaciclovir |
Drug Info | Approved | Virus infection | ICD11: 1A24-1D9Z | [1] |
Valacyclovir Hydrochloride |
Drug Info | Approved | Herpes simplex virus infection | ICD11: 1F00 | [1] |
Valganciclovir |
Drug Info | Approved | Virus infection | ICD11: 1A24-1D9Z | [2] |
Valganciclovir |
Drug Info | Approved | Virus infection | ICD11: 1A24-1D9Z | [3] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

