Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN776) | |||||
|---|---|---|---|---|---|
| DME Name | (R)-beta-hydroxybutyrate dehydrogenase (BDH2), Homo sapiens | ||||
| Gene Name | BDH2 | ||||
| UniProt ID | |||||
| EC Number | EC: 1.1.1.- (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYPGIQTRVLDVT
KKKQIDQFANEVERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKM LAQKSGNIINMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTV DTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIID GGWSL |
||||
| Structure | |||||
| Function | NAD(H)-dependent dehydrogenase/reductase with a preference for cyclic substrates (By similarity). Catalyzes stereoselective conversion of 4-oxo-L-proline to cis-4-hydroxy-L-proline, likely a detoxification mechanism for ketoprolines . Mediates the formation of 2,5-dihydroxybenzoate (2,5-DHBA), a siderophore that chelates free cytoplasmic iron and associates with LCN2, thereby regulating iron transport and homeostasis while protecting cells against free radical-induced oxidative stress. The iron-siderophore complex is imported into mitochondria, providing an iron source for mitochondrial metabolic processes in particular heme synthesis (By similarity). May act as a 3-hydroxybutyrate dehydrogenase . | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs in Phase 2 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Phenylbutyrate |
Drug Info | Phase 2 | Phenylketonuria | ICD11: 5C50 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | New secondary metabolites of phenylbutyrate in humans and rats | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.