Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DMEN795) | |||||
---|---|---|---|---|---|
DME Name | Butyrylcholinesterase (BCHE), Homo sapiens | ||||
Gene Name | BCHE | ||||
UniProt ID | |||||
Lineage |
Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) |
||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Sequence |
AVQFTGWSSSCILHFPEVLHDFHSLQTLPSLLQRIGNPNETQNNSTSWPVFKSTEQKYLT
LNTESTRIMTKLRAQQCRFWTSFFPKVLEMTEPICCYCEPGTALAARAAQMKMTGSAYSQ |
||||
Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.