Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DMEN795)
DME Name Butyrylcholinesterase (BCHE), Homo sapiens
Gene Name BCHE
UniProt ID
H7C4Y0_HUMAN
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
AVQFTGWSSSCILHFPEVLHDFHSLQTLPSLLQRIGNPNETQNNSTSWPVFKSTEQKYLT
LNTESTRIMTKLRAQQCRFWTSFFPKVLEMTEPICCYCEPGTALAARAAQMKMTGSAYSQ
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR009466 Clinprost Isocarbacyclin Hydrolysis - Hydrolysis Clinprost [1], [2], [3]
References
1 Blood-brain-barrier transport of lipid microspheres containing clinprost, a prostaglandin I2 analogue
2 Binding affinities of isocarbacyclin methyl ester and its free acid to prostanoid receptors
3 Species differences in hydrolysis of isocarbacyclin methyl ester (TEI-9090) by blood esterases

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.