Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN850) | |||||
|---|---|---|---|---|---|
| DME Name | Class A carbapenemase (bla KPC-2), Klebsiella pneumoniae | ||||
| Gene Name | bla KPC-2 | ||||
| UniProt ID | |||||
| Lineage | Species: Klebsiella pneumoniae (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
LSWPLAGFSATALTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFK
GFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEK |
||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Ceftazidime |
Drug Info | Approved | Bacterial infection | ICD11: 1A00-1C4Z | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Natural Variants of the KPC-2 Carbapenemase have Evolved Increased Catalytic Efficiency for Ceftazidime Hydrolysis at the Cost of Enzyme Stability | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.