Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN856) | |||||
|---|---|---|---|---|---|
| DME Name | 11-beta-hydroxysteroid dehydrogenase (Hsd11b2), Rattus norvegicus | ||||
| Gene Name | Hsd11b2 | ||||
| UniProt ID | |||||
| EC Number | EC: 1.1.1.- (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Rattus norvegicus (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Highly expressed in kidney, adrenal gland and distal colon, and at much lower levels in lung, hypothalamus, hippocampus, and midbrain. . | ||||
| Sequence |
MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALVV
LAGAGWIALSRLARPPRLPVATRAVLITGCDTGFGKETAKKLDAMGFTVLATVLDLNGPG ALELRARCSPRLKLLQMDLTKPEDISRVLEITKAHTASTGLWGLVNNAGLNMVVADVELS PVVTFRECMEVNFFGALELTKGLLPLLRHSRGRIVTVGSPAGDMPYPCLAAYGTSKAAIA LLMDTFSCELLPWGIKVSIIQPGCFKTEAVTNVNLWEKRKQLLLANLPRELLQAYGEDYI EHLHGQFLNSLRMALPDLSPVVDAIIDALLAAQPRSRYYTGRGLGLMYFIHHYLPGGLRR RFLQNFFISHLLPRALRPGQPGPVHDTTQDPNPSPTVSAL |
||||
| Function | Catalyzes the conversion of biologically active 11beta-hydroxyglucocorticoids (11beta-hydroxysteroid) such as corticosterone, to inactive 11-ketoglucocorticoids (11-oxosteroid) such as 11-dehydrocorticosterone, in the presence of NAD(+) . Functions as a dehydrogenase (oxidase), thereby decreasing the concentration of active glucocorticoids, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids . Plays an important role in maintaining glucocorticoids balance during preimplantation and protects the fetus from excessive maternal corticosterone exposure . Catalyzes the oxidation of 11beta-hydroxytestosterone (11beta,17beta-dihydroxyandrost-4-ene-3-one) to 11-ketotestosterone (17beta-hydroxyandrost-4-ene-3,11-dione), a major bioactive androgen (By similarity). Catalyzes the conversion of 11beta-hydroxyandrostenedione (11beta-hydroxyandrost-4-ene-3,17-dione) to 11-ketoandrostenedione (androst-4-ene-3,11,17-trione), which can be further metabolized to 11-ketotestosterone (By similarity). Converts 7-beta-25-dihydroxycholesterol to 7-oxo-25-hydroxycholesterol in vitro (By similarity). 7-beta-25-dihydroxycholesterol (not 7-oxo-25-hydroxycholesterol) acts as ligand for the G-protein-coupled receptor (GPCR) Epstein-Barr virus-induced gene 2 (EBI2) and may thereby regulate immune cell migration (By similarity). | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Metyrapone |
Drug Info | Approved | Cushing syndrome | ICD11: 5A70 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Oral pharmacokinetics and in-vitro metabolism of metyrapone in male rats | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.