Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN860) | |||||
|---|---|---|---|---|---|
| DME Name | Putative hydrolase RBBP9 (Rbbp9), Mus musculus | ||||
| Gene Name | Rbbp9 | ||||
| UniProt ID | |||||
| EC Number | EC: 3.-.-.- (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Mus musculus (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Expressed in spleen. . | ||||
| Sequence |
MASPNKAVIVPGNGGGDVATHGWYGWVKKGLEQIPGFQCLAKNMPDPITARESIWLPFME
TELHCDEKTIIIGHSSGAIAAMRYAETHQVYALVLVSAYTSDLGDENERASGYFSRPWQW EKIKANCPHIVQFGSTDDPFLPWKEQQEVADRLDAKLYKFTDRGHFQNTEFHELISVVKS MLKGPE |
||||
| Function | Serine hydrolase whose substrates have not been identified yet. May negatively regulate basal or autocrine TGF-beta signaling by suppressing SMAD2-SMAD3 phosphorylation. May play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta through interaction with RB1 and the subsequent displacement of E2F1. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
Valaciclovir |
Drug Info | Approved | Virus infection | ICD11: 1A24-1D9Z | [1] |
Valacyclovir Hydrochloride |
Drug Info | Approved | Herpes simplex virus infection | ICD11: 1F00 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Chemoproteomic Identification of Serine Hydrolase RBBP9 as a Valacyclovir-Activating Enzyme | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.