Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN863) | |||||
|---|---|---|---|---|---|
| DME Name | Dehydrogenase/reductase SDR family member 11 (DHRS11), Homo sapiens | ||||
| Gene Name | DHRS11 | ||||
| UniProt ID | |||||
| EC Number | EC: 1.1.1.270 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MARPGMERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGY
PGTLIPYRCDLSNEEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFNV NVLALSICTREAYQSMKERNVDDGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGL RQELREAQTHIRATCISPGVVETQFAFKLHDKDPEKAAATYEQMKCLKPEDVAEAVIYVL STPAHIQIGDIQMRPTEQVT |
||||
| Structure | |||||
| Function | Catalyzes the conversion of the 17-keto group of estrone, 4- and 5-androstenes and 5-alpha-androstanes into their 17-beta-hydroxyl metabolites and the conversion of the 3-keto group of 3-, 3,17- and 3,20- diketosteroids into their 3-hydroxyl metabolites. Exhibits reductive 3-beta-hydroxysteroid dehydrogenase activity toward 5-beta-androstanes, 5-beta-pregnanes, 4-pregnenes and bile acids. May also reduce endogenous and exogenous alpha-dicarbonyl compounds and xenobiotic alicyclic ketones. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Loxoprofen gel |
Drug Info | Approved | Inflammation | ICD11: 1A00-CA43 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Human dehydrogenase/reductase (SDR family) member 11 is a novel type of 17-hydroxysteroid dehydrogenase | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

