Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN871) | |||||
|---|---|---|---|---|---|
| DME Name | VIM-1 metallo-beta-lactamase (blaVIM), Pseudomonas aeruginosa | ||||
| Gene Name | blaVIM | ||||
| UniProt ID | |||||
| Lineage | Species: Pseudomonas aeruginosa (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MLKVISSLLVYMTASVMAVASPLAHSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHIATQ
SFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRV GGVDVLRAAGVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHS TDNLVVYVPSANVLYGGCAVHELSSTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGH GLPGGLDLLQHTANVVKAHKNRSVAE |
||||
| Structure | |||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Azlocillin |
Drug Info | Approved | Pseudomonas infection | ICD11: 1B92 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Purification and biochemical characterization of the VIM-1 metallo-beta-lactamase | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.