Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1065) | |||||
|---|---|---|---|---|---|
| DME Name | Nitroreductase (NTR), Trichomonas vaginalis | ||||
| Synonyms | FMN reductase (NAD(P)H); FMN reductase NADPH; nfrA2; TVAG_026310 | ||||
| Gene Name | NTR | ||||
| UniProt ID | |||||
| Gene ID | |||||
| EC Number | EC: 1.5.1.39 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Trichomonas vaginalis (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human vagina. | ||||
| Sequence |
MTSVFECIERRRTIRHYDQNWVCPKEHLEAIVNAALKSPTACNRQSIDLLVITNKEVLDK
IGEVGLNTLKKGTKEHMEERKHEGYKNVFTCDAPVLFLLVKNDRVNPLYTDVDAGIMCES IMLTAASYGYGTMCIGVLRATDLYEAVGIHKEDLAMAVCMGKIEDGYVPPEKPIKCKATY IE |
||||
| Function | This enzyme can reduce other azo dyes, such as Methyl Red, Rocceline, Solar Orange and Sumifix Black B. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Metronidazole |
Drug Info | Approved | Amebiasis | ICD11: 1A36 | [1] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

