Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1141) | |||||
|---|---|---|---|---|---|
| DME Name | Aminoglycoside acetyltransferase (aac), Providencia stuartii | ||||
| Synonyms | Aminoglycoside 2'-N-acetyltransferase; AAC(2')-Ia; aac | ||||
| Gene Name | aac | ||||
| UniProt ID | |||||
| Gene ID | |||||
| EC Number | EC: 2.3.1.59 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Providencia stuartii (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MGIEYRSLHTSQLTLSEKEALYDLLIEGFEGDFSHDDFAHTLGGMHVMAFDQQKLVGHVA
IIQRHMALDNTPISVGYVEAMVVEQSYRRQGIGRQLMLQTNKIIASCYQLGLLSASDDGQ KLYHSVGWQIWKGKLFELKQGSYIRSIEEEGGVMGWKADGEVDFTASLYCDFRGGDQW |
||||
| Structure | |||||
| Function | This enzyme catalyzes the coenzyme A-dependent acetylation of the 2' hydroxyl or amino group of a broad spectrum of aminoglycosides. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Plazomicin |
Drug Info | Approved | Infectious cystitis | ICD11: GC00 | [1] |
| Drugs in Phase 4 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Dibekacin |
Drug Info | Phase 4 | Acute lower respiratory infection | ICD11: CA4Z | [2] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

