Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1185) | |||||
---|---|---|---|---|---|
DME Name | VanC2 ligase (vanC), Enterococcus gallinarum | ||||
Synonyms | Vancomycin C-type resistance protein VanC; VanC ligase; vanC | ||||
Gene Name | vanC | ||||
UniProt ID | |||||
EC Number |
EC: 6.3.2.4 (Click to Show/Hide the Complete EC Tree) |
||||
Lineage |
Species: Enterococcus gallinarum (Click to Show/Hide the Complete Species Lineage) |
||||
Interactome (loading-time for this interactome depdends on the speed of web connection) |
|||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MKKIAVLFGGNSPEYSVSLTSAASVIQAIDPLKYEVMTIGIAPTMDWYWYQGNLANVRND
TWLEDHKNCHQLTFSSQGFILGEKRIVPDVLFPVLHGKYGEDGCIQGLLELMNLPYVGCH VAASALCMNKWLLHQLADTMGIASAPTLLLSRYENDPATIDRFIQDHGFPIFIKPNEAGS SKGITKVTDKTALQSALTTAFAYGSTVLIQKAIAGIEIGCGILGNEQLTIGACDAISLVD GFFDFEEKYQLISATITVPAPLPLALESQIKEQAQLLYRNLGLTGLARIDFFVTNQGAIY LNEINTMPGFTGHSRYPAMMAEVGLSYEILVEQLIALAEEDKR |
||||
Function | This enzyme is required for low-level resistance to the glycopeptide antibiotic vancomycin and it may synthesize a dipeptide or a depsipeptide which is incorporated into peptidoglycan precursors and not recognized by vancomycin. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Vancomycin |
Drug Info | Approved | Methicillin-resistant staphylococcus infection | ICD11: 1D01 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Sequence of the vanC gene of Enterococcus gallinarum BM4174 encoding a D-alanine:D-alanine ligase-related protein necessary for vancomycin resistance. Gene. 1992 Mar 1;112(1):53-8. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.