Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1311) | |||||
|---|---|---|---|---|---|
| DME Name | Beta-lactamase (blaB), Salmonella enterica | ||||
| Synonyms | Penicillinase; Cephalosporinase; Beta-lactam; Beta-lactamase CTX-M-2; Cefotaximase 2; bla | ||||
| Gene Name | bla | ||||
| UniProt ID | |||||
| EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Salmonella enterica (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MMTQSIRRSMLTVMATLPLLFSSATLHAQANSVQQQLEALEKSSGGRLGVALINTADNSQ
ILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTM TLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDP RDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGS GDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAESRRDILAAAAKIVTHGF |
||||
| Function | This enzyme has cefotaxime-hydrolyzing activity. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Cefotaxime |
Drug Info | Approved | Meningitis | ICD11: 1A62 | [1] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

