Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1475) | |||||
|---|---|---|---|---|---|
| DME Name | Azoreductase (azoR), Lactobacillus acidophilus | ||||
| Synonyms | Azo-dye reductase; FMN-dependent NADH-azo compound oxidoreductase; FMN-dependent NADH-azoreductase; azoR; DCW31_09905 | ||||
| Gene Name | azoR | ||||
| UniProt ID | |||||
| EC Number | EC: 1.7.1.6 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Lactobacillus acidophilus (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MAKILVIKAHPLTIEHSRTLKILDAFMTQYKVSNPEDTIETRDLYAEEFPDIDRSMMTAW
GQLQNGVGFPDLTTQQQQQLSAYDSTTQQYIDADKVILANPMWNLSIPAKLQAWIDTICV AGKTFQYTETAEIPLVPGKKVLHIQTAGGFYDGKDFGAKYISGIMHFLGASDVQELAVEG MDHFPEKAEAFMQDGLERATALATKF |
||||
| Function | This enzyme catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Sulfasalazine |
Drug Info | Approved | Rheumatoid arthritis | ICD11: FA20 | [1], [2] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

