Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1693) | |||||
|---|---|---|---|---|---|
| DME Name | D-Lactate dehydrogenase (ldhA), Pseudomonas aeruginosa | ||||
| Synonyms | Glycolate dehydrogenase; D-lactate ferricytochrome C oxidoreductase; Fermentative lactate dehydrogenase; D-LDH; Q058_03541; ldhA | ||||
| Gene Name | ldhA | ||||
| UniProt ID | |||||
| EC Number | EC: 1.1.1.28 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Pseudomonas aeruginosa (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MRILFFSSQAYDSESFQASNHRHGFELHFQQAHLQADTAVLAQGFEVVCAFVNDDLSRPV
LERLAAGGTRLVALRSAGYNHVDLAAAEALGLPVVHVPAYSPHAVAEHAVGLILTLNRRL HRAYNRTREGDFSLHGLTGFDLHGKRVGVIGTGQIGETFARIMTGFGCELLAYDPYPNPR IQALGGRYLALDALLAESDIVSLHCPLTADTRHLIDAQRLATMKPGAMLINTGRGALVNA AALIEALKSGQLGYLGLDVYEEEADIFFEDRSDQPLQDDVLARLLSFPNVVVTAHQAFLT REALAAIADTTLDNIAAWQDGTPRNRVRA |
||||
| Function | This enzyme has D-lactate dehydrogenase activity. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs in Phase 1 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
DB-053072 |
Drug Info | Phase 1 | Prostate cancer | ICD11: 2C82 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Diverse allosteric and catalytic functions of tetrameric d-lactate dehydrogenases from three Gram-negative bacteria. AMB Express. 2014 Oct 28;4:76. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

