Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1916) | |||||
|---|---|---|---|---|---|
| DME Name | Methylthioribose kinase (mtnK), Klebsiella pneumoniae | ||||
| Synonyms | MTR kinase; 5-deoxyribose disposal kinase; 5-deoxyribose kinase; mtnK; mtrK | ||||
| Gene Name | mtnK | ||||
| UniProt ID | |||||
| EC Number | EC: 2.7.1.100 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Klebsiella pneumoniae (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MSQYHTFTAHDAVAYAQQFAGIDNPSELVSAQEVGDGNLNLVFKVFDRQGVSRAIVKQAL
PYVRCVGESWPLTLDRARLEAQTLVAHYQHSPQHTVKIHHFDPELAVMVMEDLSDHRIWR GELIANVYYPQAARQLGDYLAQVLFHTSDFYLHPHEKKAQVAQFINPAMCEITEDLFFND PYQIHERNNYPAELEADVAALRDDAQLKLAVAALKHRFFAHAEALLHGDIHSGSIFVAEG SLKAIDAEFGYFGPIGFDIGTAIGNLLLNYCGLPGQLGIRDAAAAREQRLNDIHQLWTTF AERFQALAAEKTRDAALAYPGYASAFLKKVWADAVGFCGSELIRRSVGLSHVADIDTIQD DAMRHECLRHAITLGRALIVLAERIDSVDELLARVRQYS |
||||
| Function | This enzyme catalyzes the phosphorylation of methylthioribose into methylthioribose-1-phosphate. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Methylthioribose phosphate |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Selective killing of Klebsiella pneumoniae by 5-trifluoromethylthioribose. Chemotherapeutic exploitation of the enzyme 5-methylthioribose kinase. J Biol Chem. 1990 Jan 15;265(2):831-7. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

