Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME2103) | |||||
|---|---|---|---|---|---|
| DME Name | Phosphotransferase enzyme strB (strB), Erwinia amylovora | ||||
| Synonyms | Streptomycin phosphotransferase strB; Bacterial phosphotransferase strB; strB | ||||
| Gene Name | strB | ||||
| UniProt ID | |||||
| EC Number | EC: 2.7.3.9 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Erwinia amylovora (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MFMPPVFPAHWHVSQPVLIADTFSSLVWKVSLPDGTPAIVKGLKPIEDIADELRGADYLV
WRNGRGAVRLLGRENNLMLLEYAGERMLSHIVAEHGDYQATEIAAELMAKLYAASEEPLP SALLPIRDRFAALFQRARDDQNAGCQTDYVHAAIIADQMMSNASELRGLHGDLHHENIMF SSRGWLVIDPVGLVGEVGFGAANMFYDPADRDDLCLDPRRIAQMADAFSRALDVDPRRLL DQAYAYGCLSAAWNADGEEEQRDLAIAAAIKQVRQTSY |
||||
| Function | This enzyme is enzyme I of the phosphotransferase system, and it acts only on histidine residues in specific phosphocarrier proteins of low molecular mass (9.5 kDa) involved in bacterial sugar transport. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Streptomycin |
Drug Info | Approved | Infectious endocarditis | ICD11: BB40 | [1] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

