Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN002) | |||||
|---|---|---|---|---|---|
| DME Name | Nucleoside diphosphate kinase A (NME1), Homo sapiens | ||||
| Gene Name | NME1 | ||||
| UniProt ID | |||||
| EC Number | EC: 2.7.1.30 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPF
FAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS DSVESAEKEIGLWFHPEELVDYTSCAQNWIYE |
||||
| Structure | |||||
| Function | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Possesses nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease activities. Involved in cell proliferation, differentiation and development, signal transduction, G protein-coupled receptor endocytosis, and gene expression. Required for neural development including neural patterning and cell fate determination. During GZMA-mediated cell death, works in concert with TREX1. NME1 nicks one strand of DNA and TREX1 removes bases from the free 3' end to enhance DNA damage and prevent DNA end reannealing and rapid repair. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 4 Drugs | ||||
Adenosine |
Drug Info | Approved | Atrial fibrillation | ICD11: BC81 | [1] |
Sofosbuvir |
Drug Info | Approved | Viral hepatitis | ICD11: 1E51 | [2] |
Sofosbuvir |
Drug Info | Approved | Viral hepatitis | ICD11: 1E51 | [3] |
Adefovir dipivoxil |
Drug Info | Approved | Viral hepatitis | ICD11: 1E51 | [4] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

