Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN054) | |||||
|---|---|---|---|---|---|
| DME Name | 17-beta-hydroxysteroid dehydrogenase type 6 (HSD17B6), Homo sapiens | ||||
| Gene Name | HSD17B6 | ||||
| UniProt ID | |||||
| Lineage | Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAAC
LTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPIT LCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSK YGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQ QYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTS LADYILTRSWPKPAQAV |
||||
| Function | NAD-dependent oxidoreductase with broad substrate specificity that shows both oxidative and reductive activity (in vitro). Has 17-beta-hydroxysteroid dehydrogenase activity towards various steroids (in vitro). Converts 5-alpha-androstan-3-alpha,17-beta-diol to androsterone and estradiol to estrone (in vitro). Has 3-alpha-hydroxysteroid dehydrogenase activity towards androsterone (in vitro). Has retinol dehydrogenase activity towards all-trans-retinol (in vitro). Can convert androsterone to epi-androsterone. Androsterone is first oxidized to 5-alpha-androstane-3,17-dione and then reduced to epi-andosterone. Can act on both C-19 and C-21 3-alpha-hydroxysteroids. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs in Phase 3 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
BRN-2217626 |
Drug Info | Phase 3 | Female infertility | ICD11: GA31 | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Inactivation of androgens by UDP-glucuronosyltransferase enzymes in humans Trends Endocrinol Metab. 2003 Dec;14(10):473-9. doi: 10.1016/j.tem.2003.10.005. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

