Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DMEN155) | |||||
---|---|---|---|---|---|
DME Name | Inositol polyphosphate 1-phosphatase (INPP1), Homo sapiens | ||||
Gene Name | INPP1 | ||||
UniProt ID | |||||
EC Number | EC: 3.1.3.57 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Sequence |
MSDILRELLCVSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEV
IKQNMENKFPGLEKNIFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEA LARVVHQDVAFTDPTLDSTEINVPQDILGIWVDPIDSTYQYIKGSADIKSNQGIFPCGLQ CVTILIGVYDIQTGVPLMGVINQPFVSRDPNTLRWKGQCYWGLSYMGTNMHSLQLTISRR NGSETHTGNTGSEAAFSPSFSAVISTSEKETIKAALSRVCGDRIFGAAGAGYKSLCVVQG LVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQLVYHVENEGA AGVDRWANKGGLIAYRSRKRLETFLSLLVQNLAPAETHT |
||||
Function | Mg(2+)-dependent phosphatase that catalyzes the hydrolysis of the 1-position phosphate from inositol 1,4-bisphosphate and inositol 1,3,4-trisphosphate and participates in inositol phosphate metabolism. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
DMI-tetrakisphosphate |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1], [2] |
DMI-trisphosphate |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1], [2] |
Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||||||||
References | |||||
---|---|---|---|---|---|
1 | The metabolism of inositol 1,3,4-trisphosphate to inositol 1,3-bisphosphate | ||||
2 | Formation and metabolism of inositol 1,3,4,5-tetrakisphosphate in liver |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.