Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN192) | |||||
|---|---|---|---|---|---|
| DME Name | Carbonic anhydrase 3 (CA3), Bos taurus | ||||
| Gene Name | CA3 | ||||
| UniProt ID | |||||
| EC Number | EC: 4.2.1.1 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Bos taurus (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MAKEWGYADHNGPDHWHELFPNAKGENQSPIELNTKEISHDPSLKPWTASYDPGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLAAPYRLRQFHLHWGSSDDHGSEHSVDGVKYAAELHL VHWNSKYNSYATALKHADGIAVVGVFLKIGREKGEFQLLLDALDKIKTKGKEAPFNNFNP SCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPITVSSDQIAKLRTLYSSAENEPPVPL VRNWRPPQPIKGRIVKASFK |
||||
| Function | Reversible hydration of carbon dioxide. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Nitrophenyl acetate |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Hydrolysis of 4-nitrophenyl acetate catalyzed by carbonic anhydrase III from bovine skeletal muscle. J Biol Chem. 1986 Aug 5;261(22):10100-3. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.