Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN201) | |||||
|---|---|---|---|---|---|
| DME Name | Alpha-acetolactate decarboxylase (aldB), Lactococcus lactis subsp. lactis | ||||
| Gene Name | aldB | ||||
| UniProt ID | |||||
| EC Number | EC: 4.1.1.5 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Lactococcus lactis subsp. lactis (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MTEITQLFQYNTLGALMAGLYEGTMTIGELLKHGDLGIGTLDSVDGELIVLDGKAYQAKG
DKTIVELTDDIKVPYAAVVPHQAEVVFKQKFTASDKELEDRIESYFDGQNLFRSIKITGE FPKMHVRMIPRAKSGTRFVEVSQNQPEYTEENVKGTIVGIWTPEMFHGVSVAGYHLHFIS EDFTFGGHVLDFIIDNGTVEIGAIDQLNQSFPVQDRKFLFADLDIEALKKDIDVAE |
||||
| Function | Converts acetolactate into acetoin. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Oxaloacetate |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Mechanism of citrate metabolism by an oxaloacetate decarboxylase-deficient mutant of Lactococcus lactis IL1403 | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.