Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN222) | |||||
|---|---|---|---|---|---|
| DME Name | PF03932 family protein CutC (cutC), Proteus mirabilis | ||||
| Gene Name | cutC | ||||
| UniProt ID | |||||
| Lineage | Species: Proteus mirabilis (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MAKLEICCFGAECALIAERSGADRIELCTSPSEGGVTPSYGILKQVIDLVRIPVHPIIRP
RGGDFCYSQADFAAMKNDISMIRDMGFSGAVVGILNEEGHIDLPKMAILMELAGPLAITF HRAFDMCINPLLALDQLTQLGVARILTSGQQANAELGLPLLRTLNEKTQGPIIMAGAGVR LSNIQKFLDSGLQEIHSSAGKQAPSTMNYRKAGVTMSSDSEVDEFTHYCVDEDVVGAMKD IMSIYTTSVN |
||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Cholini alfosceras |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | The Nutritional Supplement L-Alpha Glycerylphosphorylcholine Promotes Atherosclerosis | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

