Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN227) | |||||
|---|---|---|---|---|---|
| DME Name | Thiol S-methyltransferase TMT1B (TMT1B), Homo sapiens | ||||
| Gene Name | TMT1B | ||||
| UniProt ID | |||||
| EC Number | EC: 2.1.1.9 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MDILVPLLQLLVLLLTLPLHLMALLGCWQPLCKSYFPYLMAVLTPKSNRKMESKKRELFS
QIKGLTGASGKVALLELGCGTGANFQFYPPGCRVTCLDPNPHFEKFLTKSMAENRHLQYE RFVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLFFWEHVAEPY GSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMG KAVK |
||||
| Function | Thiol S-methyltransferase that catalyzes the transfer of a methyl group from S-adenosyl-l-methionine to hydrogen sulfide and other thiol compounds including dithiothreitol, 7alpha-thiospironolactone, L-penicillamine, and captopril. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
Ibrutinib |
Drug Info | Approved | Mantle cell lymphoma | ICD11: 2A85 | [1] |
Penicillamine |
Drug Info | Approved | Rheumatoid arthritis | ICD11: FA20 | [2] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Extrahepatic metabolism of ibrutinib | ||||
| 2 | Human METTL7B is an alkyl thiol methyltransferase that metabolizes hydrogen sulfide and captopril | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

