Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN755) | |||||
|---|---|---|---|---|---|
| DME Name | Cyclohexanol dehydrogenase (chnA), Acinetobacter sp. | ||||
| Gene Name | chnA | ||||
| UniProt ID | |||||
| EC Number | EC: 1.1.1.245 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Acinetobacter sp. (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MEKIMSNKFNNKVALITGAGSGIGKSTALLLAQQGVSVVVSDINLEAAQKVVDEIVALGG
KAAANKANTAEPEDMKAAVEFAVSTFGALHLAFNNAGILGEVNSTEELSIEGWRRVIDVN LNAVFYSMHYEVPAILAAGGGAIVNTASIAGLIGIQNISGYVAAKHGVTGLTKAAALEYA DKGIRINSVHPGYIKTPLIAEFEEAEMVKLHPIGRLGQPEEVAQVVAFLLSDDASFVTGS QYVVDGAYTSK |
||||
| Function | Catalyzes the oxidation of cyclohexanol to cyclohexanone. Required for the conversion of cyclohexanol to adipic acid. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs in Phase 2 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
CXL |
Drug Info | Phase 2 | Methicillin-resistant staphylococci infection | ICD11: 1A00-1A09 | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | The metabolism of cyclohexanol by Acinetobacter NCIB 9871 | ||||
| 2 | Enzyme reactions involved in anaerobic cyclohexanol metabolism by a denitrifying Pseudomonas species | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.