Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN811) | |||||
|---|---|---|---|---|---|
| DME Name | Betaine--homocysteine S-methyltransferase 1 (BHMT), Homo sapiens | ||||
| Gene Name | BHMT | ||||
| UniProt ID | |||||
| EC Number | EC: 2.1.1.5 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLH
REFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAG GVSQTPSYLSCKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKP VAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARL KAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCC GFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASG RPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ |
||||
| Structure | |||||
| Function | Involved in the regulation of homocysteine metabolism. Converts betaine and homocysteine to dimethylglycine and methionine, respectively. This reaction is also required for the irreversible oxidation of choline. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Betaine |
Drug Info | Approved | Inborn error of metabolism | ICD11: 5C50-5C59 | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Health Functionalities of Betaine in Patients With Homocystinuria | ||||
| 2 | Betaine in human nutrition | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

