Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN825) | |||||
|---|---|---|---|---|---|
| DME Name | Thymidine kinase (TK1), Homo sapiens | ||||
| Gene Name | TK1 | ||||
| UniProt ID | |||||
| EC Number | EC: 2.7.1.21 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSSSFCTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVI VAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVIGGADK YHSVCRLCYFKKASGQPAGPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPAN |
||||
| Structure | |||||
| Function | Cell-cycle-regulated enzyme of importance in nucleotide metabolism . Catalyzes the first enzymatic step in the salvage pathway converting thymidine into thymidine monophosphate . Transcriptional regulation limits expression to the S phase of the cell cycle and transient expression coincides with the oscillation in the intracellular dTTP concentration (Probable). Also important for the activation of anticancer and antiviral nucleoside analog prodrugs such as 1-b-d-arabinofuranosylcytosine (AraC) and 3c-azido-3c-deoxythymidine (AZT) . | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
Valaciclovir |
Drug Info | Approved | Virus infection | ICD11: 1A24-1D9Z | [1] |
Valacyclovir Hydrochloride |
Drug Info | Approved | Herpes simplex virus infection | ICD11: 1F00 | [2] |
| Drugs in Phase 3 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Clevudine |
Drug Info | Phase 3 | Hepatitis B virus infection | ICD11: 1E50-1E51 | [3] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

