Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T11211
|
||||
| Former ID |
TTDS00367
|
||||
| Target Name |
Androgen receptor
|
||||
| Gene Name |
AR
|
||||
| Synonyms |
Dihydrotestosterone receptor; Testosterone receptor; AR
|
||||
| Target Type |
Successful
|
||||
| Disease | Alopecia [ICD9: 704.09; ICD10: L65.9] | ||||
| Alcoholic hepatitis [ICD9: 571.1; ICD10: K70.1] | |||||
| Acne vulgaris [ICD9: 706.1; ICD10: L70.0] | |||||
| Advanced prostate cancer [ICD9: 185; ICD10: C61] | |||||
| Bladder cancer [ICD9: 188; ICD10: C67] | |||||
| Castration-resistant prostate cancer [ICD9: 185; ICD10: C61] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Cardiovascular disorder [ICD10: I00-I99] | |||||
| Cachexia [ICD9: 799.4; ICD10: R64] | |||||
| Cystic fibrosis [ICD9: 277; ICD10: E84] | |||||
| Contraception [ICD10: Z30] | |||||
| Dysmenorrhea [ICD9: 625.3; ICD10: N94.4-N94.6] | |||||
| Dermatological disease [ICD10: L00-L99] | |||||
| Endocrine disease [ICD10: E00-E35] | |||||
| Female androgenresponsive recurrent mammary cancer [ICD9: 174, 175; ICD10: C50] | |||||
| Hormone deficiency [ICD10: E00-E90] | |||||
| Heart failure [ICD9: 428; ICD10: I50] | |||||
| Hormone refractory prostate cancer [ICD9: 140-229, 185; ICD10: C61] | |||||
| Hypogonadism [ICD9: 257.2; ICD10: E23.0, E28.3, E29.1] | |||||
| Metastatic prostate cancer [ICD9: 185; ICD10: C61] | |||||
| Male hormonal deficiencies [ICD10: E20-E35] | |||||
| Male hypogonadism; Breast cancer [ICD9:257.2, 174, 175; ICD10: E23.0, E28.3, E29.1, C50] | |||||
| Metastatic castration-resistant prostate cancer [ICD9: 140-229, 185; ICD10: C61] | |||||
| Muscle atrophy [ICD10: M62.5] | |||||
| Osteoporosis in post-menopausal women [ICD9: 733; ICD10: M80-M81] | |||||
| Osteoporosis [ICD9: 733.0, V07.4; ICD10: M80-M81, Z79.890] | |||||
| Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
| Prostate cancer [ICD9: 185; ICD10: C61] | |||||
| Prostate hyperplasia [ICD10: N40] | |||||
| Testosterone deficiency [ICD10: E29.1] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
Steroid hormone receptors are ligand-activated transcription factors that regulate eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Transcription factor activity is modulated by bound coactivator and corepressor proteins. Transcription activation is down-regulated by NR0B2. Activated, but not phosphorylated, by HIPK3 and ZIPK/DAPK3.
|
||||
| BioChemical Class |
Zinc-finger
|
||||
| Target Validation |
T11211
|
||||
| UniProt ID | |||||
| Sequence |
MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQ
QQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQ SALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSAD LKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELC KAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAG KSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQ SRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAA GPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAP YGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRL ETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRN DCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKL TVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWA KALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSR MYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELD RIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEII SVQVPKILSGKVKPIYFHTQ |
||||
| Structure |
1E3G; 1GS4; 1T5Z; 1T63; 1T65; 1XJ7; 1XOW; 1XQ3; 1Z95; 2AM9; 2AMA; 2AMB; 2AO6; 2AX6; 2AX7; 2AX8; 2AX9; 2AXA; 2HVC; 2OZ7; 2PIO; 2PIP; 2PIQ; 2PIR; 2PIT; 2PIU; 2PIV; 2PIW; 2PIX; 2PKL; 2PNU; 2Q7I; 2Q7J; 2Q7K; 2Q7L; 2YHD; 2YLO; 2YLP; 2YLQ; 2Z4J; 3B5R; 3B65; 3B66; 3B67; 3B68; 3BTR; 3L3X; 3L3Z; 3RLJ; 3RLL; 3V49; 3V4A; 3ZQT; 4HLW; 4K7A; 4OEA; 4OED; 4OEY; 4OEZ; 4OFR; 4OFU; 4OGH; 4OH5; 4OH6; 4OHA; 4OIL; 4OIU; 4OJ9; 4OJB; 4OK1; 4OKB; 4OKT; 4OKW; 4OKX; 4OLM
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Bicalutamide | Drug Info | Approved | Advanced prostate cancer | [536361], [539888] |
| Cyproterone | Drug Info | Approved | Prostate cancer | [550706] | |
| Dromostanolone | Drug Info | Approved | Female androgenresponsive recurrent mammary cancer | [536361], [541986] | |
| Enzalutamide | Drug Info | Approved | Metastatic castration-resistant prostate cancer | [524719], [541894], [551871] | |
| Ethylestrenol | Drug Info | Approved | Testosterone deficiency | [551871] | |
| Flufenamic Acid | Drug Info | Approved | Dysmenorrhea | [539575], [551871] | |
| Fluoxymesterone | Drug Info | Approved | Male hypogonadism; Breast cancer | [536361], [539886], [551871] | |
| Flutamide | Drug Info | Approved | Prostate cancer | [538297], [541984] | |
| Hydroxyflutamide | Drug Info | Approved | Prostate cancer | [536387], [539887] | |
| Nandrolone | Drug Info | Approved | Osteoporosis in post-menopausal women | [536361], [541987] | |
| Nilutamide | Drug Info | Approved | Prostate cancer | [536387], [539889] | |
| Oxandrolone | Drug Info | Approved | Alcoholic hepatitis | [538317], [542098] | |
| Testosterone | Drug Info | Approved | Osteoporosis | [536296], [539883] | |
| DHEA | Drug Info | Phase 4 | Cardiovascular disorder | [525084], [539508] | |
| Dihydrotestosterone | Drug Info | Phase 4 | Prostate hyperplasia | [521560], [539881] | |
| ZANOTERONE | Drug Info | Phase 3 | Prostate hyperplasia | [545244] | |
| Androgen restored contraceptive | Drug Info | Phase 2 | Contraception | [527054] | |
| Antiandrogens | Drug Info | Phase 2 | Endocrine disease | [529385] | |
| ASCJ-9 topical | Drug Info | Phase 2 | Alopecia | [523346] | |
| CB-03-01 | Drug Info | Phase 2 | Acne vulgaris | [548553] | |
| Liproca Depot | Drug Info | Phase 2 | Prostate cancer | [525060] | |
| MK-0773 | Drug Info | Phase 2 | Osteoporosis | [522114] | |
| Testogen TDS | Drug Info | Phase 2 | Hypogonadism | [524351] | |
| Testosterone | Drug Info | Phase 2 | Hormone deficiency | [550655] | |
| TOK-001 | Drug Info | Phase 2 | Prostate cancer | [532794], [543224] | |
| APC-100 | Drug Info | Phase 1/2 | Castration-resistant prostate cancer | [550204] | |
| ONC1-13B | Drug Info | Phase 1/2 | Metastatic prostate cancer | [549513] | |
| AZD-3514 | Drug Info | Phase 1 | Hormone refractory prostate cancer | [523468] | |
| AZD5312 | Drug Info | Phase 1 | Prostate cancer | [524767] | |
| Drug 2881078 | Drug Info | Phase 1 | Heart failure | [525334] | |
| PS-178990 | Drug Info | Phase 1 | Muscle atrophy | [548632] | |
| TESTOSTERONE BUCICLATE | Drug Info | Phase 1 | Contraception | [526819] | |
| GLPG-0492 | Drug Info | Preclinical | Cachexia | [547691] | |
| GW-275919 | Drug Info | Discontinued in Phase 2 | Pain | [546813] | |
| HE-2000 | Drug Info | Discontinued in Phase 2 | Cystic fibrosis | [546877] | |
| NP-619 | Drug Info | Discontinued in Phase 2 | Alopecia | [548745] | |
| Testosterone glucoside | Drug Info | Discontinued in Phase 2 | Hypogonadism | [547667] | |
| GSK2849466 | Drug Info | Discontinued in Phase 1 | Heart failure | [549417] | |
| LGD2941 | Drug Info | Discontinued in Phase 1 | Osteoporosis | [547162] | |
| Opterone | Drug Info | Discontinued in Phase 1 | Hormone deficiency | [547562] | |
| PF-06260414 | Drug Info | Discontinued in Phase 1 | Cachexia | [549537] | |
| LG-2293 | Drug Info | Terminated | Prostate cancer | [546195] | |
| ZD-3980 | Drug Info | Terminated | Prostate hyperplasia | [546660] | |
| Testosterone | Drug Info | Investigative | Male hormonal deficiencies | [535239], [536683] | |
| Inhibitor | 1,2-dibromo-4-(1,2-dibromoethyl)cyclohexane | Drug Info | [528558] | ||
| 11-methyl-6,11-dihydro-5H-benzo[a]carbazol-9-ol | Drug Info | [528123] | |||
| 6,11-dihydrothiochromeno[4,3-b]indol-8-ol | Drug Info | [528123] | |||
| 9alpha-Fluorocortisol | Drug Info | [551374] | |||
| APC-100 | Drug Info | [550204] | |||
| Calusterone | Drug Info | [551389] | |||
| Flufenamic Acid | Drug Info | [551392] | |||
| HE-2000 | Drug Info | [526848] | |||
| Methyltrienolone | Drug Info | [551393] | |||
| Mibolerone | Drug Info | [525861] | |||
| Opterone | Drug Info | [533385] | |||
| OXENDLONE | Drug Info | [534505] | |||
| Palodesangren C | Drug Info | [534505] | |||
| Palodesangren D | Drug Info | [534505] | |||
| Palodesangren E | Drug Info | [534505] | |||
| RU-59063 | Drug Info | [525861] | |||
| TOK-001 | Drug Info | [543224] | |||
| ZANOTERONE | Drug Info | [527548] | |||
| Modulator | 2849466 | Drug Info | |||
| Andromustine | Drug Info | [1572605] | |||
| ASC-JMZ1 | Drug Info | [1572605] | |||
| AZD5312 | Drug Info | ||||
| Dihydrotestosterone | Drug Info | ||||
| Drug 2881078 | Drug Info | [549527] | |||
| Enzalutamide | Drug Info | [551871] | |||
| EPI-001 | Drug Info | [525416] | |||
| Ethylestrenol | Drug Info | ||||
| GLPG-0492 | Drug Info | [532281] | |||
| GSK2849466 | Drug Info | [549418] | |||
| GTx-027 | Drug Info | [552011] | |||
| GW-275919 | Drug Info | [546813] | |||
| LG-2293 | Drug Info | [546196] | |||
| LGD2941 | Drug Info | [530124] | |||
| MK-0773 | Drug Info | [530821] | |||
| NP-619 | Drug Info | [548746] | |||
| PF-06260414 | Drug Info | [550356] | |||
| RAD-140 | Drug Info | [552010] | |||
| SARMs | Drug Info | [1572605] | |||
| Selective androgen receptor degraders | Drug Info | [1572605] | |||
| Testogen TDS | Drug Info | [533385] | |||
| ZD-3980 | Drug Info | [546661] | |||
| Antagonist | Alpha-estradiol | Drug Info | [534842] | ||
| Antiandrogens | Drug Info | [531856] | |||
| ARN34 | Drug Info | [535939] | |||
| ASC-JMX2 | Drug Info | [1572605] | |||
| AZD-3514 | Drug Info | [532431] | |||
| Bicalutamide | Drug Info | [535561], [537480] | |||
| CB-03-01 | Drug Info | [527374] | |||
| CH-4933468 | Drug Info | [1572605] | |||
| Cyproterone | Drug Info | [537365] | |||
| DHEA | Drug Info | [525358] | |||
| DL-3 | Drug Info | [1572605] | |||
| Flutamide | Drug Info | [535561] | |||
| Hydroxyflutamide | Drug Info | [534842], [535939], [536387] | |||
| HYG-440 | Drug Info | [552008] | |||
| Liproca Depot | Drug Info | [527745] | |||
| Nilutamide | Drug Info | [536659] | |||
| ONC1-13B | Drug Info | [532660] | |||
| SX-ARPC | Drug Info | [551681] | |||
| Agonist | Androgen receptor modulators | Drug Info | [1572605] | ||
| Androgen restored contraceptive | Drug Info | [551483] | |||
| Boldenone | Drug Info | [551393] | |||
| Delta1-dihydrotestosterone | Drug Info | [551383] | |||
| Fluoxymesterone | Drug Info | [536288], [537750] | |||
| Nandrolone | Drug Info | [536093] | |||
| Oxandrolone | Drug Info | [536376] | |||
| Testetrol | Drug Info | [525360] | |||
| Testosterone | Drug Info | [535239], [536683] | |||
| TESTOSTERONE BUCICLATE | Drug Info | [533385] | |||
| Testosterone glucoside | Drug Info | [533385] | |||
| Enhancer | ASCJ-9 topical | Drug Info | [532450] | ||
| Binder | Dromostanolone | Drug Info | [536002], [537807] | ||
| PS-178990 | Drug Info | [544063] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| Pathways | |||||
| KEGG Pathway | Oocyte meiosis | ||||
| Pathways in cancer | |||||
| Prostate cancer | |||||
| NetPath Pathway | EGFR1 Signaling Pathway | ||||
| AndrogenReceptor Signaling Pathway | |||||
| FSH Signaling Pathway | |||||
| Pathway Interaction Database | Regulation of nuclear SMAD2/3 signaling | ||||
| Coregulation of Androgen receptor activity | |||||
| Regulation of Androgen receptor activity | |||||
| Nongenotropic Androgen signaling | |||||
| Regulation of nuclear beta catenin signaling and target gene transcription | |||||
| FOXA1 transcription factor network | |||||
| Notch-mediated HES/HEY network | |||||
| Reactome | Nuclear Receptor transcription pathway | ||||
| Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 | |||||
| WikiPathways | SIDS Susceptibility Pathways | ||||
| Integrated Pancreatic Cancer Pathway | |||||
| Prostate Cancer | |||||
| Integrated Breast Cancer Pathway | |||||
| Nuclear Receptors | |||||
| Androgen receptor signaling pathway | |||||
| References | |||||
| Ref 521560 | ClinicalTrials.gov (NCT00062790) Effect Of Dutasteride On Intraprostatic Dihydrotestosterone (DHT) Levels. U.S. National Institutes of Health. | ||||
| Ref 522114 | ClinicalTrials.gov (NCT00529659) A Study of the Safety and Efficacy of MK-0773 in Women With Sarcopenia (Loss of Muscle Mass)(MK-0773-005). U.S. National Institutes of Health. | ||||
| Ref 523346 | ClinicalTrials.gov (NCT01289574) Topical ASC-J9 Cream for Acne. U.S. National Institutes of Health. | ||||
| Ref 523468 | ClinicalTrials.gov (NCT01351688) An Open Label Prostate Cancer Study in Japanese Patients. U.S. National Institutes of Health. | ||||
| Ref 524351 | ClinicalTrials.gov (NCT01894308) A Dose Ranging Study to Examine Testagen TDS-Testosterone 5%. U.S. National Institutes of Health. | ||||
| Ref 524719 | ClinicalTrials.gov (NCT02116582) A Study to Evaluate Enzalutamide After Abiraterone in Metastatic Castration-Resistant Prostate Cancer. U.S. National Institutes of Health. | ||||
| Ref 524767 | ClinicalTrials.gov (NCT02144051) Phase I Open Label Dose Escalation Study to Investigate the Safety & Pharmacokinetics of AZD5312 in Patients With Androgen Receptor Tumors. U.S. National Institutes of Health. | ||||
| Ref 525060 | ClinicalTrials.gov (NCT02341404) A Study of 2-hydroxyflutamide (Liproca Depot), Injected Into the Prostate in Patients With Localized Prostate Cancer. U.S. National Institutes of Health. | ||||
| Ref 525084 | ClinicalTrials.gov (NCT02357472) The Effect of a Higher Dose of Dehydroepiandrosterone (DHEA) Supplementation in Poor Responders. U.S. National Institutes of Health. | ||||
| Ref 525334 | ClinicalTrials.gov (NCT02567773) Safety, Tolerability, Pharmacokinetic (PK), and Pharmacodynamic Study of GSK2881078 and Study to Evaluate the Effect of CYP3A4 Inhibition on PK of GSK2881078. | ||||
| Ref 526819 | Testosterone buciclate (20 Aet-1) in hypogonadal men: pharmacokinetics and pharmacodynamics of the new long-acting androgen ester. J Clin Endocrinol Metab. 1992 Nov;75(5):1204-10. | ||||
| Ref 527054 | Treatment outcome in endodontics-the Toronto Study. Phase II: initial treatment. J Endod. 2004 May;30(5):302-9. | ||||
| Ref 529385 | Phase II study of the pure non-steroidal antiandrogen nilutamide in prostatic cancer. Italian Prostatic Cancer Project (PONCAP). Eur J Cancer. 1991;27(9):1100-4. | ||||
| Ref 532794 | Galeterone prevents androgen receptor binding to chromatin and enhances degradation of mutant androgen receptor. Clin Cancer Res. 2014 Aug 1;20(15):4075-85. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 536387 | Drug insight: role of the androgen receptor in the development and progression of prostate cancer. Nat Clin Pract Oncol. 2007 Apr;4(4):236-44. | ||||
| Ref 538297 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 075298. | ||||
| Ref 538317 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 076761. | ||||
| Ref 539508 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2370). | ||||
| Ref 539575 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2447). | ||||
| Ref 539881 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2856). | ||||
| Ref 539883 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2858). | ||||
| Ref 539886 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2861). | ||||
| Ref 539887 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2862). | ||||
| Ref 539888 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2863). | ||||
| Ref 539889 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2864). | ||||
| Ref 541894 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6812). | ||||
| Ref 541984 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6943). | ||||
| Ref 541986 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6947). | ||||
| Ref 541987 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6949). | ||||
| Ref 542098 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7092). | ||||
| Ref 543224 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8638). | ||||
| Ref 545244 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002570) | ||||
| Ref 546195 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006840) | ||||
| Ref 546660 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009538) | ||||
| Ref 546813 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010426) | ||||
| Ref 546877 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010830) | ||||
| Ref 547162 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013541) | ||||
| Ref 547562 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017332) | ||||
| Ref 547667 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018266) | ||||
| Ref 547691 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018432) | ||||
| Ref 548553 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026561) | ||||
| Ref 548632 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027228) | ||||
| Ref 548745 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028305) | ||||
| Ref 549417 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800036899) | ||||
| Ref 549513 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800039208) | ||||
| Ref 525358 | Dehydroepiandrosterone, glucose-6-phosphate dehydrogenase, and longevity. Ageing Res Rev. 2004 Apr;3(2):171-87. | ||||
| Ref 525360 | Estetrol review: profile and potential clinical applications. Climacteric. 2008;11 Suppl 1:47-58. | ||||
| Ref 525416 | EPI-001 is a selective peroxisome proliferator-activated receptor-gamma modulator with inhibitory effects on androgen receptor expression and activity in prostate cancer. Oncotarget. 2015 Feb 28;6(6):3811-24. | ||||
| Ref 525861 | J Med Chem. 2000 Aug 24;43(17):3344-7.Design, synthesis, and pharmacological characterization of 4-[4, 4-dimethyl-3-(4-hydroxybutyl)-5-oxo-2-thioxo-1-imidazolidinyl]- 2-iodobenzonitrile as a high-affinity nonsteroidal androgen receptor ligand. | ||||
| Ref 526848 | Dehydroepiandrosterone upregulates neural androgen receptor level and transcriptional activity. J Neurobiol. 2003 Nov;57(2):163-71. | ||||
| Ref 527374 | Biological profile of cortexolone 17alpha-propionate (CB-03-01), a new topical and peripherally selective androgen antagonist. Arzneimittelforschung. 2004;54(12):881-6. | ||||
| Ref 527548 | J Med Chem. 1992 May 15;35(10):1663-70.Antiandrogenic steroidal sulfonyl heterocycles. Utility of electrostatic complementarity in defining bioisosteric sulfonyl heterocycles. | ||||
| Ref 527745 | Effects of dihydrotestosterone and hydroxyflutamide on androgen receptors in cultured human breast cancer cells (EVSA-T). J Steroid Biochem Mol Biol. 1992 Jun;42(5):547-54. | ||||
| Ref 528123 | Bioorg Med Chem Lett. 2006 Jun 15;16(12):3233-7. Epub 2006 Apr 5.Discovery of indole-containing tetracycles as a new scaffold for androgen receptor ligands. | ||||
| Ref 528558 | J Med Chem. 2006 Dec 14;49(25):7366-72.Identification of the brominated flame retardant 1,2-dibromo-4-(1,2-dibromoethyl)cyclohexane as an androgen agonist. | ||||
| Ref 530124 | Influence of testosterone and a novel SARM on gene expression in whole blood of Macaca fascicularis. J Steroid Biochem Mol Biol. 2009 Apr;114(3-5):167-73. | ||||
| Ref 530821 | Discovery of the selective androgen receptor modulator MK-0773 using a rational development strategy based on differential transcriptional requirements for androgenic anabolism versus reproductive physiology. J Biol Chem. 2010 May 28;285(22):17054-64. | ||||
| Ref 531856 | Steroid derivatives as pure antagonists of the androgen receptor. J Steroid Biochem Mol Biol. 2012 Oct;132(1-2):93-104. | ||||
| Ref 532281 | GLPG0492, a novel selective androgen receptor modulator, improves muscle performance in the exercised-mdx mouse model of muscular dystrophy. Pharmacol Res. 2013 Jun;72:9-24. | ||||
| Ref 532431 | AZD3514: a small molecule that modulates androgen receptor signaling and function in vitro and in vivo. Mol Cancer Ther. 2013 Sep;12(9):1715-27. | ||||
| Ref 532450 | Anti-androgen receptor ASC-J9 versus anti-androgens MDV3100 (Enzalutamide) or Casodex (Bicalutamide) leads to opposite effects on prostate cancer metastasis via differential modulation of macrophage infiltration and STAT3-CCL2 signaling. Cell Death Dis. 2013 Aug 8;4:e764. | ||||
| Ref 532660 | Preclinical Development of ONC1-13B, Novel Antiandrogen for Prostate Cancer Treatment. J Cancer. 2014 Jan 21;5(2):133-42. | ||||
| Ref 533385 | Evidence for a role of testosterone-androgen receptor interactions in mediating masculine sexual behavior in male rats. Endocrinology. 1989 Feb;124(2):618-26. | ||||
| Ref 534505 | J Nat Prod. 1997 Oct;60(10):997-1002.Antiandrogenic natural Diels--Alder-type adducts from Brosimum rubescens. | ||||
| Ref 534842 | Androgen antagonistic effect of estramustine phosphate (EMP) metabolites on wild-type and mutated androgen receptor. Biochem Pharmacol. 1998 May 1;55(9):1427-33. | ||||
| Ref 535561 | Androgen receptor as a target in androgen-independent prostate cancer. Urology. 2002 Sep;60(3 Suppl 1):132-8; discussion 138-9. | ||||
| Ref 535939 | Ectopic expression of the amino-terminal peptide of androgen receptor leads to androgen receptor dysfunction and inhibition of androgen receptor-mediated prostate cancer growth. Mol Cell Endocrinol. 2004 Feb 12;214(1-2):175-87. | ||||
| Ref 536002 | Endocrinological and pathological effects of anabolic-androgenic steroid in male rats. Endocr J. 2004 Aug;51(4):425-34. | ||||
| Ref 536093 | Expression of androgen receptor on fibroblast and hepatocyte of rats after deep second-degree burn caused by scalding. Sichuan Da Xue Xue Bao Yi Xue Ban. 2005 May;36(3):362-4. | ||||
| Ref 536288 | An orally active selective androgen receptor modulator is efficacious on bone, muscle, and sex function with reduced impact on prostate. Endocrinology. 2007 Jan;148(1):363-73. Epub 2006 Oct 5. | ||||
| Ref 536376 | The effect of oxandrolone treatment on human osteoblastic cells. J Burns Wounds. 2007 Mar 7;6:e4. | ||||
| Ref 536387 | Drug insight: role of the androgen receptor in the development and progression of prostate cancer. Nat Clin Pract Oncol. 2007 Apr;4(4):236-44. | ||||
| Ref 536659 | CX3CR1 is expressed by prostate epithelial cells and androgens regulate the levels of CX3CL1/fractalkine in the bone marrow: potential role in prostate cancer bone tropism. Cancer Res. 2008 Mar 15;68(6):1715-22. | ||||
| Ref 537365 | Coactivator selective regulation of androgen receptor activity. Steroids. 2009 Aug;74(8):669-74. Epub 2009 Mar 9. | ||||
| Ref 537480 | Androgen receptor overexpression induces tamoxifen resistance in human breast cancer cells. Breast Cancer Res Treat. 2009 Jun 17. | ||||
| Ref 537750 | Endocrine-responsive pancreatic carcinoma: steroid binding and cytotoxicity studies in human tumor cell lines. Cancer Res. 1986 May;46(5):2276-81. | ||||
| Ref 537807 | Effects of 5-fluorouracil and 2 alpha-methyldihydrotestosterone propionate on the growth of human breast carcinoma MCF-7 in vitro. Eur J Cancer Clin Oncol. 1983 Sep;19(9):1231-7. | ||||
| Ref 543224 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8638). | ||||
| Ref 544063 | Selective androgen receptor modulators in preclinical and clinical development. Nucl Recept Signal. 2008; 6: e010. | ||||
| Ref 546196 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006840) | ||||
| Ref 546661 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009538) | ||||
| Ref 546813 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010426) | ||||
| Ref 548746 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028305) | ||||
| Ref 549418 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800036899) | ||||
| Ref 549527 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800039743) | ||||
| Ref 551383 | 17beta-hydroxy-5alpha-androst-1-en-3-one (1-testosterone) is a potent androgen with anabolic properties. Toxicol Lett. 2006 Aug 20;165(2):149-55. Epub 2006 Apr 18. | ||||
| Ref 551389 | MR appearance of intra-abdominal metastatic melanoma. Magn Reson Imaging. 1992;10(4):705-8. | ||||
| Ref 551392 | Ouellet M, Percival MD: Effect of inhibitor time-dependency on selectivity towards cyclooxygenase isoforms. Biochem J. 1995 Feb 15;306 ( Pt 1):247-51. | ||||
| Ref 551681 | Clinical pipeline report, company report or official report of Progenics Pharmaceuticals Serometrix. | ||||
| Ref 551871 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
| Ref 552010 | Design, Synthesis, and Preclinical Characterization of the Selective Androgen Receptor Modulator (SARM) RAD140. ACS Med Chem Lett. 2010 Dec 2;2(2):124-9. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

